PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G04460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 198aa    MW: 20712.6 Da    PI: 10.607
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G04460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.91.9e-12104164262
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      ke  r +r+ +NR++A+  R+RKka++ eLe k+k Le  N +L +++++l++e  +l++ 
  LPERR01G04460.1 104 KEQNRLKRLLRNRVSAQQARERKKAYMTELEAKAKDLELRNAELEQRVSTLQNENNTLRQI 164
                      78899***************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-13103167IPR004827Basic-leucine zipper domain
PfamPF001707.2E-11104165IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.185105168IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.94E-12108165No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-16108167No hitNo description
CDDcd147041.69E-14108158No hitNo description
PROSITE patternPS000360110125IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MAAQEQEQEK QQAKTSTTSS LPSSSERSSS SAPNNLKEGG VESDEEIRRV PEMGGGGGSA  60
SSGAGADERG KEDGKQSASA AAAGAGGQEQ APAARKRGRS AGDKEQNRLK RLLRNRVSAQ  120
QARERKKAYM TELEAKAKDL ELRNAELEQR VSTLQNENNT LRQILKNTTA HAGKRGGGGG  180
KGGDGGAGGG KKHHFTKS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0993981e-165FP099398.1 Phyllostachys edulis cDNA clone: bphylf024b23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968380.13e-74PREDICTED: transcription factor HY5-like
SwissprotQ9SM502e-46HY5_SOLLC; Transcription factor HY5
TrEMBLA0A0D9UXD71e-136A0A0D9UXD7_9ORYZ; Uncharacterized protein
STRINGSi002989m1e-73(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.11e-36bZIP family protein